PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr002549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 329aa    MW: 36861 Da    PI: 6.8288
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr002549.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++ +G g+W++++++ g+ R++k+c++rw +yl
      Pbr002549.1 13 RGLWSPEEDEKLRKHITTHGHGSWSSVPKHAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding56.28e-1866109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++ ++d+++ lG++ W+ Ia++++ gRt++++k++w++
      Pbr002549.1  66 RGSFTPEEEQTIIDVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 109
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-25562IPR009057Homeodomain-like
PROSITE profilePS5129418.538860IPR017930Myb domain
SuperFamilySSF466894.87E-3010107IPR009057Homeodomain-like
SMARTSM007172.3E-131262IPR001005SANT/Myb domain
PfamPF002498.8E-161360IPR001005SANT/Myb domain
CDDcd001674.02E-111660No hitNo description
PROSITE profilePS5129426.58561115IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2663115IPR009057Homeodomain-like
SMARTSM007178.2E-1665113IPR001005SANT/Myb domain
PfamPF002492.0E-1666109IPR001005SANT/Myb domain
CDDcd001671.79E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGHRCCGKQK VKRGLWSPEE DEKLRKHITT HGHGSWSSVP KHAGLQRCGK SCRLRWINYL  60
RPELRRGSFT PEEEQTIIDV HRILGNKWAQ IAKHLPGRTD NEVKNFWNSC IKKKLMSQGL  120
DPKTHNLLPN SHHQRSASNN ASSSSQSPLL QSHNQQQPVS VSLTEMDAST INVTLSTDQY  180
HDHGQNPSNA SWTRVDDPTF NDITRLPHQQ STDHSTLINN ISSSSPSSSV NLSVFGLLEN  240
SNIWASGTEP FEAPSLLVGE QSKGEEVVLQ QEKNTLLDQM EIKGIEDMDH ASIFESSSVD  300
FSFVESTLMS CGEISQDLNS MCNFAWRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363371.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLM5WK831e-133M5WK83_PRUPE; Uncharacterized protein
STRINGVIT_19s0085g00940.t016e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.15e-85myb domain protein 67